PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0461s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 506aa    MW: 57338.9 Da    PI: 5.9388
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0461s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS356.53.9e-1091235043374
                    GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             + Lle A+a+++++ ++ q+l++ l+el sp+gd+ q+la+yf++AL +r+++s++++y++l + ++++ + +++ +++  f+evsP
  SapurV1A.0461s0030.1.p 123 DILLETAHAIADKNSARLQQLMWMLNELGSPYGDTEQKLASYFLQALFSRMTDSGERCYRTLGSASEKTCSFESTRKMVLKFQEVSP 209
                             689***********************************************************6666654554444445556****** PP

                    GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..............skeeleetg 162
                             + +f+h+ +N aI+ea+ege+++HiiD++ ++++QWp+Ll+aLa+R++++p+lR+T+v++++s+               ++ ++e+g
  SapurV1A.0461s0030.1.p 210 WTTFGHVSCNGAIMEAFEGESKLHIIDISNTYCTQWPTLLEALATRTDETPHLRLTTVVASKSSgntigvsstgglasVHKVMKEIG 296
                             *********************************************************999887789**********99999****** PP

                    GRAS 163 erLakfAeelgvpfefnvlvak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                             +r++kfA+ +gvpf+fnv+++  +l dl+l eL+vk +Eala+n+v +lh++     +++++rd v++ +++l+P++++vve+ead+
  SapurV1A.0461s0030.1.p 297 NRMEKFARLMGVPFKFNVIHHAgDLCDLNLAELDVKDDEALAINCVGALHSIT----PVSHRRDYVISSFRRLQPRIITVVEEEADL 379
                             *******************7777*****************************8....77777899********************** PP

                    GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                             ++ +F+++f e+l+++ + f++l++++pr+s+e+ ++Er+  gr+iv++vac  ++++er+et+ +W+ rl++ GF++v +s+++ +
  SapurV1A.0461s0030.1.p 380 DGLDFVKGFQECLRWFRVYFEALDESFPRTSNEQLMLERA-AGRAIVDLVACPPSDSIERRETATRWSGRLHSNGFSSVMFSDEVCD 465
                             ****************************************.********************************************** PP

                    GRAS 336 qaklllrkvksdg.yrveeesgslvlgWkdrpLvsvSaWr 374
                             ++++llr++k +g  + ++ ++ ++l+Wk++p+v++SaWr
  SapurV1A.0461s0030.1.p 466 DVRALLRRYK-EGwSMTQCGDAGIFLCWKEQPVVWASAWR 504
                             **********.66255567788899**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.29695484IPR005202Transcription factor GRAS
PfamPF035141.3E-106123504IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MDTLFRLVSL QQQSEQSFNS TSRTSSSSRS SRQNNNHHHH HYQQEDEECF NYFMDDEDFS  60
SSSSKHYYPY HHQQQHQTIT TTPTTTTTNT STPSTHHALD PTDFSFSPSH DLNFEFSGQW  120
VTDILLETAH AIADKNSARL QQLMWMLNEL GSPYGDTEQK LASYFLQALF SRMTDSGERC  180
YRTLGSASEK TCSFESTRKM VLKFQEVSPW TTFGHVSCNG AIMEAFEGES KLHIIDISNT  240
YCTQWPTLLE ALATRTDETP HLRLTTVVAS KSSGNTIGVS STGGLASVHK VMKEIGNRME  300
KFARLMGVPF KFNVIHHAGD LCDLNLAELD VKDDEALAIN CVGALHSITP VSHRRDYVIS  360
SFRRLQPRII TVVEEEADLD GLDFVKGFQE CLRWFRVYFE ALDESFPRTS NEQLMLERAA  420
GRAIVDLVAC PPSDSIERRE TATRWSGRLH SNGFSSVMFS DEVCDDVRAL LRRYKEGWSM  480
TQCGDAGIFL CWKEQPVVWA SAWRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3315550437375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2169410.0AC216941.1 Populus trichocarpa clone POP023-N18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376791.10.0hypothetical protein POPTR_0012s06430g
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLB9NAS90.0B9NAS9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s06430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein